PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G40180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 820aa    MW: 90671.1 Da    PI: 5.9598
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G40180.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS386.92.2e-1184448132374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL++cA+ v+++d + a++lL++++++a  +gd  qRla++f+++L+arla+++s++yk  + ++ +    +++l+a++l+  ++P+ k+sh
  ORUFI01G40180.1 444 ETLLIHCAQSVATDDRRSATELLKQIRQHAHANGDGDQRLAHCFANGLEARLAGTGSQIYKNYTITRLP---CTDVLKAYQLYLAACPFKKISH 534
                      789************************************************************999999...9********************* PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                        aNq+Il+ave++++vHi+D++i +G+QWp+L+q L++Rp+gpp+lRiTg++ p++g   +e++eetg+ L+++A++++vpfef++ +a+r+e
  ORUFI01G40180.1 535 YFANQTILNAVEKAKKVHIVDYGIYYGFQWPCLIQRLSNRPGGPPKLRITGIDTPQPGfrPAERTEETGRYLSDYAQTFNVPFEFQA-IASRFE 627
                      ***************************************************************************************.7***** PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                      ++++e+L+++++E+l+Vn++++ ++l+desv  es+r+  Lk++++++P+v+++   + ++n++ F++rf eal +ysa+fd+le+++p+++e+
  ORUFI01G40180.1 628 AVRMEDLHIEEDEVLIVNCMFKFKNLMDESVVAESPRNMALKTIRKMNPHVFIHGVVNGSYNAPFFVTRFREALFHYSAIFDMLETNIPKDNEQ 721
                      ********************************************************************************************** PP

             GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      r  +E +l++re+ nv++ceg er er et+++W+ r +++GFk++pl+++++k a+  +r +++d + ++e++ +l++gWk+r L+++S W+
  ORUFI01G40180.1 722 RLLIESALFSREAINVISCEGLERMERPETYKQWQVRNQRVGFKQLPLNQDMMKRAREKVRCYHKD-FIIDEDNRWLLQGWKGRILFALSTWK 813
                      ****************************************************************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.115417794IPR005202Transcription factor GRAS
PfamPF035147.7E-116444813IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 820 aa     Download sequence    Send to blast
MVMDAGVHDV CTMLPGSKRD AHLPLPIYPQ IAAANGFATA EEFDPLLFLS PDAVCGGGGG  60
DYLNIVSAQP ISAASTNGAS PPRDVSVSAS AASSAAAQHD DSEAFSDIVL GYINRMLMAE  120
DIDEKFEHYP VNADDLLAAE KPFLEILADQ SPYSGGSSVE SPDGSSAANS CNSLSPCNCS  180
SSSDGLGAVP QTPVLEFPTA AFSQTPQLYG DLIPTGGMVE SGGAWPYDPT EFYQLQTKPV  240
RENLPSQSSS FASSNGSSVT FSEGFESLLS PAGVLPDVSL NDFVVQNQQA LQFRRGFQEA  300
SKFLPDESKL VIDVDKLYSG DEGSRFLGEV RQEKKLVKVK TETSDVESAG HRGKKHFYGD  360
DLDAEEGRCS KHSAQGIDTD HLVRDLMDKV LLCNGETCSK GVKELREALQ HDVAKHSGGG  420
HGKGSSHGKG RGKKQPKKEV VDLETLLIHC AQSVATDDRR SATELLKQIR QHAHANGDGD  480
QRLAHCFANG LEARLAGTGS QIYKNYTITR LPCTDVLKAY QLYLAACPFK KISHYFANQT  540
ILNAVEKAKK VHIVDYGIYY GFQWPCLIQR LSNRPGGPPK LRITGIDTPQ PGFRPAERTE  600
ETGRYLSDYA QTFNVPFEFQ AIASRFEAVR MEDLHIEEDE VLIVNCMFKF KNLMDESVVA  660
ESPRNMALKT IRKMNPHVFI HGVVNGSYNA PFFVTRFREA LFHYSAIFDM LETNIPKDNE  720
QRLLIESALF SREAINVISC EGLERMERPE TYKQWQVRNQ RVGFKQLPLN QDMMKRAREK  780
VRCYHKDFII DEDNRWLLQG WKGRILFALS TWKPDNRSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-514478138375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0032400.0AP003240.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0406G08.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619294.10.0PREDICTED: scarecrow-like protein 9 isoform X1
TrEMBLA0A0E0N4T10.0A0A0E0N4T1_ORYRU; Uncharacterized protein
TrEMBLQ5N9X30.0Q5N9X3_ORYSJ; Os01g0842200 protein
STRINGLOC_Os01g62460.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125183137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-176GRAS family protein